PDB entry 6ypa

View 6ypa on RCSB PDB site
Description: The C146A variant of an amidase from Pyrococcus horikoshii with bound glutaramide
Class: hydrolase
Keywords: amidase of the nitrilase superfamily, HYDROLASE
Deposited on 2020-04-15, released 2020-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CN hydrolase domain-containing protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (20-281)
      • expression tag (19)
      • engineered mutation (165)
    Domains in SCOPe 2.08: d6ypaa1, d6ypaa2
  • Chain 'B':
    Compound: CN hydrolase domain-containing protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (20-281)
      • expression tag (13-19)
      • engineered mutation (165)
    Domains in SCOPe 2.08: d6ypab1, d6ypab2
  • Chain 'C':
    Compound: CN hydrolase domain-containing protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (20-281)
      • expression tag (19)
      • engineered mutation (165)
    Domains in SCOPe 2.08: d6ypac1, d6ypac2
  • Chain 'D':
    Compound: CN hydrolase domain-containing protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0642
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58376 (20-281)
      • expression tag (18-19)
      • engineered mutation (165)
    Domains in SCOPe 2.08: d6ypad1, d6ypad2
  • Heterogens: P6W, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ypaA (A:)
    mgsshhhhhhssglvprgshmvkvgyiqmepkileldknyskaeklikeaskegaklvvl
    pelfdtgynfesreevfdvaqqipegetttflmelarelglyivagtaeksgnylynsav
    vvgprgyigkyrkihlfyrekvffepgdlgfkvfdigfakvgvmiafdwffpesartlal
    kgaeiiahpanlvmpyaprampiralenrvytitadrvgeerglkfigksliaspkaevl
    siaseteeeigvveidlnlarnkrlndmndifkdrreeyyfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ypaA (A:)
    hmvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdv
    aqqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyr
    ekvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyapr
    ampiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnl
    arnkrlndmndifkdrreeyyfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ypaB (B:)
    mgsshhhhhhssglvprgshmvkvgyiqmepkileldknyskaeklikeaskegaklvvl
    pelfdtgynfesreevfdvaqqipegetttflmelarelglyivagtaeksgnylynsav
    vvgprgyigkyrkihlfyrekvffepgdlgfkvfdigfakvgvmiafdwffpesartlal
    kgaeiiahpanlvmpyaprampiralenrvytitadrvgeerglkfigksliaspkaevl
    siaseteeeigvveidlnlarnkrlndmndifkdrreeyyfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ypaB (B:)
    lvprgshmvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesr
    eevfdvaqqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrk
    ihlfyrekvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlv
    mpyaprampiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvv
    eidlnlarnkrlndmndifkdrreeyyfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ypaC (C:)
    mgsshhhhhhssglvprgshmvkvgyiqmepkileldknyskaeklikeaskegaklvvl
    pelfdtgynfesreevfdvaqqipegetttflmelarelglyivagtaeksgnylynsav
    vvgprgyigkyrkihlfyrekvffepgdlgfkvfdigfakvgvmiafdwffpesartlal
    kgaeiiahpanlvmpyaprampiralenrvytitadrvgeerglkfigksliaspkaevl
    siaseteeeigvveidlnlarnkrlndmndifkdrreeyyfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ypaC (C:)
    hmvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdv
    aqqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyr
    ekvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyapr
    ampiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnl
    arnkrlndmndifkdrreeyyfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ypaD (D:)
    mgsshhhhhhssglvprgshmvkvgyiqmepkileldknyskaeklikeaskegaklvvl
    pelfdtgynfesreevfdvaqqipegetttflmelarelglyivagtaeksgnylynsav
    vvgprgyigkyrkihlfyrekvffepgdlgfkvfdigfakvgvmiafdwffpesartlal
    kgaeiiahpanlvmpyaprampiralenrvytitadrvgeerglkfigksliaspkaevl
    siaseteeeigvveidlnlarnkrlndmndifkdrreeyyfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ypaD (D:)
    shmvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfd
    vaqqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfy
    rekvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyap
    rampiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidln
    larnkrlndmndifkdrreeyyfr