PDB entry 6yp8

View 6yp8 on RCSB PDB site
Description: 14-3-3 sigma with rela/p65 binding site ps45 and covalently bound tcf521-033
Deposited on 2020-04-15, released 2020-09-23
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'P':
    Compound: p65pS45
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YP8 (Start-12)
  • Heterogens: P6Z, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6yp8A (A:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6yp8P (P:)
egrsagsipgrrs

    Sequence, based on observed residues (ATOM records):
    >6yp8P (P:)
agsipgrrs