PDB entry 6yop

View 6yop on RCSB PDB site
Description: Structure of SAMM50 LIR bound to GABARAP
Class: signaling protein
Keywords: lir, samm50, atg8, signaling protein
Deposited on 2020-04-14, released 2021-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorting and assembly machinery component 50 homolog,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y512 (Start-15)
      • linker (16-17)
    • Uniprot O95166 (18-134)
    Domains in SCOPe 2.08: d6yopa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yopA (A:)
eeaefvevepeakqeigsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarig
dldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheed
fflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >6yopA (A:)
aefvevepeakqeigsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdl
dkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedff
lyiaysdesvygl