PDB entry 6yoo

View 6yoo on RCSB PDB site
Description: Structure of SAMM50 LIR bound to GABARAPL1
Class: signaling protein
Keywords: lir, samm50, atg8, signaling protein
Deposited on 2020-04-14, released 2021-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAPL1, GEC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0R8 (6-122)
      • expression tag (5)
    Domains in SCOPe 2.08: d6yooa1, d6yooa2
  • Chain 'B':
    Compound: Sorting and assembly machinery component 50 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SAMM50, SAM50, CGI-51, TRG3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yooA (A:)
gptmgsmkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsd
ltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesv
ygk

    Sequence, based on observed residues (ATOM records): (download) 
    >6yooA (A:)
smkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdltvgq
fyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesvygk

  • Chain 'B':
    No sequence available.