PDB entry 6yo3

View 6yo3 on RCSB PDB site
Description: LecA from Pseudomonas aeruginosa in complex with a catechol CAS no. 67984-81-0
Class: sugar binding protein
Keywords: Non-carbohydrate glycomimetics, PAINS, lectin, catechols, SUGAR BINDING PROTEIN
Deposited on 2020-04-14, released 2020-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: lecA, pa1L, PA2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yo3a_
  • Chain 'B':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: lecA, pa1L, PA2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yo3b_
  • Chain 'C':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: lecA, pa1L, PA2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yo3c_
  • Chain 'D':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: lecA, pa1L, PA2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yo3d_
  • Heterogens: P3K, CA, P6G, EDO, PG4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6yo3A (A:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6yo3B (B:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6yo3C (C:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6yo3D (D:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s