PDB entry 6yk7

View 6yk7 on RCSB PDB site
Description: Crystal structure of p38 in complex with SR43
Class: transferase
Keywords: kinase, kinase inhibitor, MAPK, MAPK14, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2020-04-05, released 2020-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6yk7a_
  • Heterogens: OU2, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6yk7A (A:)
    gmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpf
    qsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkc
    qkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddem
    tgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlv
    gtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkrita
    aqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6yk7A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglyvatrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvpppldq