PDB entry 6yjh

View 6yjh on RCSB PDB site
Description: crystal structure of imidazole glycerol phosphate dehydratase from mycobacterium tuberculosis at 1.61 a resolution
Deposited on 2020-04-03, released 2021-04-14
The last revision was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YJH (0-190)
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6yjhA (A:)
srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve
ieahhtiedtaialgtalgqalgdkrgirrfgdafipmdetlahaavdlsgrpycvhtge
pdhlqhttiagssvpyhtvinrhvfeslaanarialhvrvlygrdphhiteaqykavara
lrqavepdprv