PDB entry 6yig

View 6yig on RCSB PDB site
Description: crystal structure of the n-terminal ef-hand domain of arabidopsis thaliana ateh1/pan1
Deposited on 2020-04-01, released 2021-04-14
The last revision was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding EF hand family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g20760, F2D10.25, F2D10_25
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6yigA (A:)
ggmagqnpnmdqfeayfkradldgdgrisgaeavgffqgsglskqvlaqiwslsdrshsg
fldrqnfynslrlvtvaqskrdltpeivnaalntpaaakipppkinlsa

    Sequence, based on observed residues (ATOM records):
    >6yigA (A:)
npnmdqfeayfkradldgdgrisgaeavgffqgsglskqvlaqiwslsdrshsgfldrqn
fynslrlvtvaqskrdltpeivnaalntpaaakipppkinl