PDB entry 6yi3

View 6yi3 on RCSB PDB site
Description: the n-terminal rna-binding domain of the sars-cov-2 nucleocapsid phosphoprotein
Deposited on 2020-03-31, released 2020-04-08
The last revision was dated 2020-12-30, with a file datestamp of 2020-12-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DTC9 (3-139)
      • expression tag (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6yi3A (A:)
gamglpnntaswftaltqhgkedlkfprgqgvpintnsspddqigyyrratrrirggdgk
mkdlsprwyfyylgtgpeaglpygankdgiiwvategalntpkdhigtrnpannaaivlq
lpqgttlpkgfyaegsrggs