PDB entry 6yht

View 6yht on RCSB PDB site
Description: A lid blocking mechanism of a cone snail toxin revealed at the atomic level
Class: toxin
Keywords: conkunitzin-3, TOXIN
Deposited on 2020-03-31, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conk-C1
    Species: Conus cocceus [TaxId:2547880]
    Database cross-references and differences (RAF-indexed):
    • PDB 6YHT
    Domains in SCOPe 2.08: d6yhta_
  • Heterogens: CIT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yhtA (A:)
glpslcyepadsgsgtksekriyynsarkqclrftyngkggnannfihtfdcqhtclyk

    Sequence, based on observed residues (ATOM records): (download) 
    >6yhtA (A:)
lpslcyepadsgsgtksekriyynsarkqclrftyngkggnannfihtfdcqhtcl