PDB entry 6yek

View 6yek on RCSB PDB site
Description: crystal structure of human nemo apo form
Deposited on 2020-03-25, released 2021-03-03
The last revision was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma, isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: IKBKG, hCG_2003089
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3DWY0
      • conflict (33)
      • conflict (36)
  • Chain 'B':
    Compound: Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma, isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: IKBKG, hCG_2003089
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3DWY0 (Start-88)
      • conflict (33)
      • conflict (36)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6yekA (A:)
gpmqledlkqqlqqaeealvakqevidklkeeaaqhaivmetvpvlkaqadiykadfqae
rqareklaekkellqeqleqlqreysklk

    Sequence, based on observed residues (ATOM records):
    >6yekA (A:)
qledlkqqlqqaeealvakqevidklkeeaaqhaivmetvpvlkaqadiykadfqaerqa
reklaekkellqeqleqlqreyskl

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6yekB (B:)
gpmqledlkqqlqqaeealvakqevidklkeeaaqhaivmetvpvlkaqadiykadfqae
rqareklaekkellqeqleqlqreysklk

    Sequence, based on observed residues (ATOM records):
    >6yekB (B:)
edlkqqlqqaeealvakqevidklkeeaaqhaivmetvpvlkaqadiykadfqaerqare
klaekkellqeqleqlqreysklk