PDB entry 6ye9

View 6ye9 on RCSB PDB site
Description: Small-molecule inhibitor of 14-3-3 protein-protein interactions
Class: structural protein
Keywords: 14-3-3, Inhibitor, Protein-protein interaction, small molecule, STRUCTURAL PROTEIN
Deposited on 2020-03-24, released 2021-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d6ye9a1, d6ye9a2
  • Heterogens: OO8, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ye9A (A:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt