PDB entry 6yau

View 6yau on RCSB PDB site
Description: crystal structure of asgpr 1 in complex with gn-a.
Class: sugar binding protein
Keywords: asialog glycoprotein receptor, liver Imaging, NASH, SUGAR BINDING PROTEIN
Deposited on 2020-03-13, released 2021-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ASGR1, CLEC4H1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yaua_
  • Heterogens: CA, OJB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yauA (A:)
mgsertccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhig
pvntwmglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnd
dvcqrpyrwvceteldkasqeppllgshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6yauA (A:)
ccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwm
glhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrp
yrwvcetel