PDB entry 6ya5

View 6ya5 on RCSB PDB site
Description: 2009 H1N1 PA Endonuclease in complex with LU2
Class: viral protein
Keywords: Influenza, polymerase, endonuclease, hydrolase, VIRAL PROTEIN
Deposited on 2020-03-11, released 2020-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: INFLUENZA A VIRUS (A/CALIFORNIA/07/2009(H1N1)) [TaxId:641809]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5X6 (2-51)
      • expression tag (0-1)
      • linker (52-54)
    • Uniprot C3W5X6 (55-178)
    Domains in SCOPe 2.08: d6ya5a1, d6ya5a2
  • Heterogens: LU2, MN, MG, SO4, DMS, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ya5A (A:)
gsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfe
iiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekank
iksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser