PDB entry 6y9o

View 6y9o on RCSB PDB site
Description: crystal structure of whirlin pdz3_c-ter in complex with cask internal pdz binding motif peptide
Deposited on 2020-03-10, released 2020-10-07
The last revision was dated 2020-11-11, with a file datestamp of 2020-11-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Whirlin
    Species: Mus musculus [TaxId:10090]
    Gene: Whrn, Dfnb31, Kiaa1526
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Peripheral plasma membrane protein CASK
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6y9oA (A:)
    gamgstsleptstlvrvrksaatlgiaieggantrqplprivtiqrggsahncgqlkvgh
    vilevngqtlrgkehkeaariiaeafktkerdyidflvtefnvml
    

    Sequence, based on observed residues (ATOM records):
    >6y9oA (A:)
    eptstlvrvrksaatlgiaieggantrqplprivtiqrggsahncgqlkvghvilevngq
    tlrgkehkeaariiaeafktkerdyidflvtefnvml
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6y9oC (C:)
    tapqwvpvswvy
    

    Sequence, based on observed residues (ATOM records):
    >6y9oC (C:)
    vpvswvy