PDB entry 6y7y

View 6y7y on RCSB PDB site
Description: Fragments KCL_771 and KCL_802 in complex with MAP kinase p38-alpha
Class: transferase
Keywords: fbdd, fragment based drug design, p38, mapk14, kinase, transferase
Deposited on 2020-03-02, released 2020-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6y7ya_
  • Heterogens: OFQ, LOT, SB4, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6y7yA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7yA (A:)
    ptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglvatrwyrapeimln
    wmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesar
    nyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdd
    epvadpydqsfesrdllidewksltydevisfvpppldqeeme