PDB entry 6y7s

View 6y7s on RCSB PDB site
Description: 2.85 A cryo-EM structure of the in vivo assembled type 1 pilus rod
Class: structural protein
Keywords: FimA, pilus, monomer, subunit, pili, main structural subunit, high resolution, STRUCTURAL PROTEIN, cryo-EM, helical processing, RELION, Chaperone-usher pilus
Deposited on 2020-03-02, released 2021-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7sa_
  • Chain 'B':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7sb_
  • Chain 'C':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7sc_
  • Chain 'D':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7sd_
  • Chain 'E':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7se_
  • Chain 'F':
    Compound: FimA
    Species: Escherichia coli [TaxId:562]
    Gene: fimA, fimA_3, fimA_4, AKG99_10950, AM464_16225, AUQ13_11250, B9M99_24745, B9T59_08995, BON65_08005, BON69_13175, BON76_10075, BvCms2454_04212, C5P44_07805, C6B13_05790, CR538_22075, D2188_19275, D3P01_20510, D9G11_20500, D9H70_11405, D9H94_22085, DJ503_16440, DNQ45_01525, DS732_03935, DU321_25435, E0L12_19165, ECONIH1_25830, EIA21_01505, ELV08_23950, EQ830_16750, F1E03_03280, FNJ83_00955, HMPREF3040_05526, MS6198_50780, NCTC9036_04290, NCTC9117_05374, PGD_03541, SAMEA3472056_01238
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y7sf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6y7sA (A:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sA (A:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6y7sB (B:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sB (B:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6y7sC (C:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sC (C:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6y7sD (D:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sD (D:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6y7sE (E:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sE (E:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6y7sF (F:)
    mkiktlaivvlsalslsstaalaaattvnggtvhfkgevvnaacavdagsvdqtvqlgqv
    rtaslaqegatssavgfniqlndcdtnvaskaavaflgtaidaghtnvlalqssaagsat
    nvgvqildrtgaaltldgatfssettlnngtntipfqaryfatgaatpgaanadatfkvq
    yq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y7sF (F:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq