PDB entry 6y6v

View 6y6v on RCSB PDB site
Description: p38a bound with MCP-81
Class: transferase
Keywords: Kinase, Inhibitor, MAPK14, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2020-02-27, released 2020-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y6va_
  • Heterogens: OE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6y6vA (A:)
    gmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpf
    qsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkc
    qkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddem
    tgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlv
    gtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkrita
    aqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y6vA (A:)
    erptfyrqelnktiwevperyqnlspvgygsvcaafdtktghrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgatrwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    aqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
    ydqsfesrdllidewksltydevisfvpppl