PDB entry 6y4v

View 6y4v on RCSB PDB site
Description: Crystal structure of p38 in complex with SR68
Class: transferase
Keywords: kinase, kinase inhibitor, MAPK14, MAPK, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2020-02-23, released 2020-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6y4va_
  • Heterogens: O8Z, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6y4vA (A:)
    gmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpf
    qsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkc
    qkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddem
    tgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlv
    gtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkrita
    aqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y4vA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaryvatrwyrape
    imlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkiss
    esarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyh
    dpddepvadpydqsfesrdllidewksltydevisfvpppldq