PDB entry 6y4h

View 6y4h on RCSB PDB site
Description: solution structure of cold-shock domain 7 and 8 of drosophila upstream of n-ras (unr)
Deposited on 2020-02-21, released 2020-07-29
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Upstream of N-ras, isoform A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Unr, BcDNA:LD13080, CR32028, DmelCG7015, dUNR, MRE30, UNR, unr, CG7015, Dmel_CG7015
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VSK3 (1-167)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6y4hA (A:)
gagsdagqvyrgfiavmkenfgfietlshdeevffhfsnymgnpnwlelgqeveytlarn
gntsvsgnclpaenvrmlpknsipqpavletthngvvarplrcinpdqqeyaglieilde
lrttvisqhefgitslvnkrdllqkgdlvsfridesgraacvnavrqk