PDB entry 6y4e

View 6y4e on RCSB PDB site
Description: x-ray structure of the zn-dependent receptor-binding domain of proteus mirabilis mr/p fimbrial adhesin mrph
Deposited on 2020-02-20, released 2020-08-19
The last revision was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fimbrial adhesin
    Species: Proteus mirabilis (strain HI4320) [TaxId:529507]
    Gene: mrpH, PMI0270
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4EUK6 (0-128)
      • expression tag (129-132)
  • Heterogens: ZN, TLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6y4eA (A:)
    sifsyitestgtpsnatytyvierwdpetsgilnpcygwpvcyvtvnhkhtvngtggnpa
    fqiarieklrtlaevrdvvlknrsfpiegqtthrgpslnsnqecvglfyqpnssgisprg
    kllpgslcgahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6y4eA (A:)
    sifsyitestgtpsnatytyvierwdpetsgilnpcygwpvcyvtvnhkhtvngtggnpa
    fqiarieklrtlaevrdvvlknrsfpiegqtthrgpslnsnqecvglfyqpnssgisprg
    kllpgslcgahhh