PDB entry 6y3i

View 6y3i on RCSB PDB site
Description: NMR solution structure of the hazelnut allergen Cor a 1.0402
Class: allergen
Keywords: PR-10 related protein, hazelnut allergen, ALLERGEN
Deposited on 2020-02-18, released 2021-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major allergen variant Cor a 1.0402
    Species: Corylus avellana [TaxId:13451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6y3ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6y3iA (A:)
    gvfsyedeatsvipparlfksfvldadnlipkvapqhftgaenlegnggpgtikkitfae
    gsefkymkhkveeidhanfkycysiieggplghtlekisyeikmaaaphgggsilkitsk
    yhtkgnasiseeeikagkekaaglfkaveayllahpdtyc