PDB entry 6y2w

View 6y2w on RCSB PDB site
Description: Crystal structure of the single mutant I16K of Low Molecular Weight Protein Tyrosine Phosphatase (LMW-PTP)
Class: hydrolase
Keywords: Engineered, HYDROLASE
Deposited on 2020-02-17, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24666 (Start-156)
      • engineered mutation (15)
    Domains in SCOPe 2.08: d6y2wa_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6y2wA (A:)
    aeqatksvlfvclgnkcrspiaeavfrklvtdqnisenwvidsgavsdwnvgrspdprav
    sclrnhgihtahkarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
    pqkqliiedpyygndsdfetvyqqcvrccraflekah
    

    Sequence, based on observed residues (ATOM records): (download)
    >6y2wA (A:)
    tksvlfvclgnkcrspiaeavfrklvtdqnisenwvidsgavsdwnvgrspdpravsclr
    nhgihtahkarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqkq
    liiedpyygndsdfetvyqqcvrccraflekah