PDB entry 6y24

View 6y24 on RCSB PDB site
Description: Crystal structure of fourth KH domain of FUBP1
Class: RNA binding protein
Keywords: KH4, Structural Genomics, Structural Genomics Consortium, SGC, RNA BINDING PROTEIN
Deposited on 2020-02-14, released 2020-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Far upstream element-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FUBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6y24a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6y24A (A:)
smqgnwnmgppgglqefnfivptgktgliigkggetiksisqqsgarielqrnpppnadp
nmklftirgtpqqidyarqlieekiggpvnplg

    Sequence, based on observed residues (ATOM records): (download) 
    >6y24A (A:)
glqefnfivptgktgliigkggetiksisqqsgarielqrnpppnadpnmklftirgtpq
qidyarqlieekiggpvnpl