PDB entry 6y1p

View 6y1p on RCSB PDB site
Description: Human Aldose Reductase Mutant L300/301A in Complex with a Ligand with an IDD Structure (3-({[2-(carboxymethoxy)-4-fluorobenzoyl]amino}methyl)benzoic acid)
Class: oxidoreductase
Keywords: Oxidoreductase, L300/301A Mutant, SAR061, Opened Transient Pocket
Deposited on 2020-02-13, released 2021-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-24, with a file datestamp of 2021-02-19.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member B1
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B1, ALDR1, ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-315)
      • conflict (4)
      • engineered mutation (300-301)
    Domains in SCOPe 2.08: d6y1pa_
  • Heterogens: 4G7, CIT, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6y1pA (A:)
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
aasctshkdypfheef