PDB entry 6xyv

View 6xyv on RCSB PDB site
Description: nmr solution structure of the iron-sulfur protein pioc from rhodopseudomonas palustris tie-1
Deposited on 2020-01-31, released 2020-11-11
The last revision was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PioC
    Species: Rhodopseudomonas palustris TIE-1 [TaxId:395960]
    Gene: Rpal_0815
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6xyvA (A:)
    vtkkashkdagyqespngakrcgtcrqfrppsscitvespisengwcrlyagka