PDB entry 6xyh

View 6xyh on RCSB PDB site
Description: nmr solution structure of alpha-anmtx-ms11a-2 (ms11a-2)
Deposited on 2020-01-30, released 2021-02-10
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ams3
    Species: Metridium senile [TaxId:6116]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XYH (0-39)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6xyhA (A:)
gcknlnshcyrqhrecchglvcrrpnygngrgilwkcvra