PDB entry 6xxp

View 6xxp on RCSB PDB site
Description: Crystal structure of NB37, a nanobody targeting prostate specific membrane antigen
Class: antitumor protein
Keywords: Nanobody, prostate-specific membrane antigen, antibody drug conjugate, cancer imaging, anti-cancer drugs., ANTITUMOR PROTEIN
Deposited on 2020-01-28, released 2020-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nb_37
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XXP (0-End)
    Domains in SCOPe 2.08: d6xxpa1, d6xxpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6xxpA (A:)
qvqlqesgggsveaggslrlscarsgwpystysmnwfrqapgkereavagisstmsgiif
aeskagqftisqdnakntvylqmnnlkpedtaiyycaarrdyslssssddfdywgqgtqv
tvssaaaypydvpdygshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6xxpA (A:)
qvqlqesgggsveaggslrlscarsgwpystysmnwfrqapgkereavagisstmsgiif
aeskagqftisqdnakntvylqmnnlkpedtaiyycaarrdyslssssddfdywgqgtqv
tvssaaa