PDB entry 6xx4

View 6xx4 on RCSB PDB site
Description: Crystal structure of the c-Src SH3 domain H122R-Q128E mutant in complex with Ni(II) at pH 7.5 co-crystallized with methyl beta-cyclodextrin
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-01-26, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (4-End)
      • expression tag (0-3)
      • engineered mutation (41)
      • engineered mutation (47)
    Domains in SCOPe 2.08: d6xx4a1, d6xx4a2
  • Heterogens: NI, ZB0, ZB2, ZB3, GLC, ZB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xx4A (A:)
    gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlarslttgetgyipsnyvaps
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xx4A (A:)
    gshmtfvalydyesrtetdlsfkkgerlqivdwwlarslttgetgyipsnyvaps