PDB entry 6xx0

View 6xx0 on RCSB PDB site
Description: Crystal structure of NEMO in complex with Ubv-LIN
Class: protein binding
Keywords: Inhibitor, Ubiquitin, PROTEIN BINDING
Deposited on 2020-01-26, released 2021-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma, isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: IKBKG, hCG_2003089
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3DWY0
      • conflict (33)
      • conflict (36)
  • Chain 'B':
    Compound: Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma, isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: IKBKG, hCG_2003089
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3DWY0
      • conflict (33)
      • conflict (36)
  • Chain 'C':
    Compound: Ubv-LIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XX0 (0-End)
    Domains in SCOPe 2.08: d6xx0c_
  • Chain 'D':
    Compound: Ubv-LIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XX0 (0-End)
    Domains in SCOPe 2.08: d6xx0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >6xx0C (C:)
gpmqinvktltgttiglevepsdtienvkakiqdkegippdqqilffsgmqledgrtlsd
yniqkesrlylvfslrgrlg

    Sequence, based on observed residues (ATOM records): (download) 
    >6xx0C (C:)
gpmqinvktltgttiglevepsdtienvkakiqdkegippdqqilffsgmqledgrtlsd
yniqkesrlylvfslr

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >6xx0D (D:)
gpmqinvktltgttiglevepsdtienvkakiqdkegippdqqilffsgmqledgrtlsd
yniqkesrlylvfslrgrlg

    Sequence, based on observed residues (ATOM records): (download) 
    >6xx0D (D:)
gpmqinvktltgttiglevepsdtienvkakiqdkegippdqqilffsgmqledgrtlsd
yniqkesrlylvfslr