PDB entry 6xwd

View 6xwd on RCSB PDB site
Description: 14-3-3 sigma bound to canonical mono-phosphorylated aminopeptidase n (apn, cd13) binding motif
Deposited on 2020-01-23, released 2020-11-04
The last revision was dated 2021-01-06, with a file datestamp of 2021-01-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'P':
    Compound: Amino peptidase N 38-46
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6XWD (Start-8)
  • Heterogens: SEP, NA, CA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6xwdA (A:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6xwdP (P:)
nknansspv

    Sequence, based on observed residues (ATOM records):
    >6xwdP (P:)
knansspv