PDB entry 6xvw

View 6xvw on RCSB PDB site
Description: Catalytic domain of human PARP-1 in complex with the inhibitor MC2050
Class: transferase
Keywords: Inhibitor, Complex, DNA-repair, TRANSFERASE
Deposited on 2020-01-22, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6xvwa1, d6xvwa2, d6xvwa3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6xvwb1, d6xvwb2, d6xvwb3
  • Heterogens: O3H, NI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xvwA (A:)
    hmsklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
    sqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrg
    gsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkie
    regecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadm
    vsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsa
    nisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfktslw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xvwA (A:)
    hmsklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
    sqgssdsqildlsnrfytliphdfgppllnnadsvqakvemldnlldievaysllrgdss
    kdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecq
    rykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksan
    ychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldg
    vdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6xvwB (B:)
    hmsklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
    sqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrg
    gsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkie
    regecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadm
    vsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsa
    nisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfktslw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xvwB (B:)
    hmsklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav
    sqgssdsqildlsnrfytliphdfpllnnadsvqakvemldnlldievaysllrggsdds
    skdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregec
    qrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksa
    nychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisld
    gvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt