PDB entry 6xvn

View 6xvn on RCSB PDB site
Description: Crystal structure of c-Src SH3 domain without ATCUN motif: monomer 1
Class: protein binding
Keywords: beta barrel, SH3 domain, PROTEIN BINDING
Deposited on 2020-01-22, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6xvna_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6xvnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xvnA (A:)
    mgsshhhhhhssgpqqglrgvttfvalydyesrtetdlsfkkgerlqivnntegdwwlah
    slttgqtgyipsnyvapsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xvnA (A:)
    gvttfvalydyesrtetdlsfkkgerlqivntegdwwlahslttgqtgyipsnyvapsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6xvnB (B:)
    mgsshhhhhhssgpqqglrgvttfvalydyesrtetdlsfkkgerlqivnntegdwwlah
    slttgqtgyipsnyvapsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xvnB (B:)
    gvttfvalydyesrtetdlsfkkgerlqivngdwwlahslttgqtgyipsnyvapsd