PDB entry 6xuw

View 6xuw on RCSB PDB site
Description: Human myelin protein P2 mutant L27D
Class: lipid binding protein
Keywords: mutant, peripheral membrane protein, FABP, beta barrel, LIPID BINDING PROTEIN
Deposited on 2020-01-21, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02689 (1-132)
      • expression tag (0)
      • engineered mutation (28)
    Domains in SCOPe 2.08: d6xuwa1, d6xuwa2
  • Heterogens: PLM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xuwA (A:)
gmsnkflgtwklvssenfddymkalgvgdatrklgnlakptviiskkgdiitirtestfk
nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
mkgvvctriyekv