PDB entry 6xum

View 6xum on RCSB PDB site
Description: Human Aldose Reductase Mutant L300/301A in Complex with a Ligand with an IDD Structure ({5-fluoro-2-[(3-nitrobenzyl)carbamoyl]phenoxy}acetic acid)
Class: oxidoreductase
Keywords: Oxidoreductase, L300/301A Mutant, IDD_06, Opened Transient Pocket, hAR
Deposited on 2020-01-20, released 2021-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member B1
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B1, ALDR1, ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-315)
      • conflict (4)
      • engineered mutation (300-301)
    Domains in SCOPe 2.08: d6xuma_
  • Heterogens: 30L, CIT, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xumA (A:)
    masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
    eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
    effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
    avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
    hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
    aasctshkdypfheef