PDB entry 6xua

View 6xua on RCSB PDB site
Description: Human myelin protein P2 mutant K21Q
Class: lipid binding protein
Keywords: mutant, peripheral membrane protein, FABP, beta barrel, LIPID BINDING PROTEIN
Deposited on 2020-01-17, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: myelin p2 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: PMP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02689 (1-132)
    • expression tag (0)
    • engineered mutation (22)
  Domains in SCOPe 2.08: d6xuab1, d6xuab2
• Heterogens: PLM, CIT, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6xuaB (B:)
  gmsnkflgtwklvssenfddymqalgvglatrklgnlakptviiskkgdiitirtestfk
  nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
  mkgvvctriyekv