PDB entry 6xtk

View 6xtk on RCSB PDB site
Description: Y114C Transthyretin structure in complex with Tolcalpone
Class: transport protein
Keywords: Drug repositioning, tolcapone, leptomeningeal amyloidosis, Transport protein
Deposited on 2020-01-16, released 2020-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (104)
    Domains in SCOPe 2.08: d6xtka_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (104)
    Domains in SCOPe 2.08: d6xtkb_
  • Heterogens: TCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xtkA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtnp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6xtkB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspcsysttavvtnp

    Sequence, based on observed residues (ATOM records): (download) 
    >6xtkB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftanrrytiaallspcsysttavvtnp