PDB entry 6xsg

View 6xsg on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V66T at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, polar group, HYDROLASE
Deposited on 2020-07-15, released 2020-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.08: d6xsga_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6xsgA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmt
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >6xsgA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmtenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws