PDB entry 6xsf

View 6xsf on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS T41V at cryogenic temperature
Class: hydrolase
Keywords: nuclease, pdTp, polar group, HYDROLASE
Deposited on 2020-07-15, released 2020-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (40)
      • engineered mutation (43-44)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.08: d6xsfa_
  • Heterogens: THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xsfA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdvpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xsfA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdvpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws