PDB entry 6xpl

View 6xpl on RCSB PDB site
Description: cutr screw, form 2 with 33.8 angstrom pitch
Deposited on 2020-07-08, released 2020-07-22
The last revision was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ethanolamine utilization protein eutS
    Species: Streptococcus intermedius SK54 = ATCC 27335 [TaxId:1095731]
    Gene: HMPREF1654_00416
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6xplA (A:)
mhhhhhhmieelgkidriiqesvpgkqitlahviaapieavyeclgvdhegaigvvsltp
netaiiaadiagaaanidicfvdrftgsvmfsgdiqsvetsledileyfknslgfstvpl
tks

    Sequence, based on observed residues (ATOM records):
    >6xplA (A:)
kqitlahviaapieavyeclgvdhegaigvvsltpnetaiiaadiagaaanidicfvdrf
tgsvmfsgdiqsvetsledileyfknslgfstvpltks