PDB entry 6xnt

View 6xnt on RCSB PDB site
Description: crystal structure of i91a mutant of human ceacam1
Deposited on 2020-07-04, released 2021-03-24
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Carcinoembryonic antigen-related cell adhesion molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CEACAM1, BGP, BGP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13688 (0-106)
    • engineered mutation (90)
• Chain 'B':
  Compound: Carcinoembryonic antigen-related cell adhesion molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: CEACAM1, BGP, BGP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13688 (0-106)
    • engineered mutation (90)
• Heterogens: BOG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xntA (A:)
  qlttesmpfnvaegkevlllvhnlpqqlfgyswykgervdgnrqivgyaigtqqatpgpa
  nsgretiypnaslliqnvtqndtgfytlqvaksdlvneeatgqfhvy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xntB (B:)
  qlttesmpfnvaegkevlllvhnlpqqlfgyswykgervdgnrqivgyaigtqqatpgpa
  nsgretiypnaslliqnvtqndtgfytlqvaksdlvneeatgqfhvy