PDB entry 6xno

View 6xno on RCSB PDB site
Description: crystal structure of e99a mutant of human ceacam1
Deposited on 2020-07-03, released 2021-03-24
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carcinoembryonic antigen-related cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CEACAM1, BGP, BGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13688 (0-106)
      • engineered mutation (98)
  • Chain 'B':
    Compound: Carcinoembryonic antigen-related cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CEACAM1, BGP, BGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13688 (0-106)
      • engineered mutation (98)
  • Heterogens: BOG, MLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6xnoA (A:)
qlttesmpfnvaegkevlllvhnlpqqlfgyswykgervdgnrqivgyaigtqqatpgpa
nsgretiypnaslliqnvtqndtgfytlqviksdlvneaatgqfhvy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6xnoB (B:)
qlttesmpfnvaegkevlllvhnlpqqlfgyswykgervdgnrqivgyaigtqqatpgpa
nsgretiypnaslliqnvtqndtgfytlqviksdlvneaatgqfhvy