PDB entry 6xnm

View 6xnm on RCSB PDB site
Description: gcn4-p1 peptide trimer with tyrosine residue at position 16
Deposited on 2020-07-03, released 2021-07-07
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GCN4-p1 Peptide with A16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Chain 'B':
  Compound: GCN4-p1 peptide with Y16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Chain 'C':
  Compound: GCN4-p1 Peptide with A16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xnmA (A:)
  rmkqledkveellskayhlenevarlkklv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xnmB (B:)
  rmkqledkveellskyyhlenevarlkklv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xnmC (C:)
  rmkqledkveellskayhlenevarlkklv