PDB entry 6xnk

View 6xnk on RCSB PDB site
Description: Crystal structure of dimeric K72A human cytochrome c alkaline conformer
Class: electron transport
Keywords: cytochrome c, cardiolipin, heme protein, ELECTRON TRANSPORT
Deposited on 2020-07-03, released 2021-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d6xnka_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d6xnkc_
  • Chain 'E':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d6xnke_
  • Chain 'G':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (71)
    Domains in SCOPe 2.08: d6xnkg_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xnkA (A:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpakyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xnkC (C:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpakyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xnkE (E:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpakyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6xnkG (G:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpakyipgtkmifvgikkkeeradliaylkkatne