PDB entry 6xnj

View 6xnj on RCSB PDB site
Description: Crystal structure of the PDZ domain of human GOPC in complex with a peptide of E. coli O157:H7 str. Sakai effector NleG8
Class: protein binding
Keywords: ubiquitination, effectors, structural genomics, center for structural genomics of infectious diseases, csgid, protein binding
Deposited on 2020-07-03, released 2020-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Golgi-associated PDZ and coiled-coil motif-containing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GOPC, CAL, FIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6xnja_
  • Chain 'B':
    Compound: NleG8 peptide
    Species: Escherichia coli O157:H7 str. Sakai [TaxId:386585]
    Gene: NleG8
    Database cross-references and differences (RAF-indexed):
    • PDB 6XNJ (Start-9)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6xnjA (A:)
sqgvgpirkvlllkedheglgisitggkehgvpiliseihpgqpadrcgglhvgdailav
ngvnlrdtkhkeavtilsqqrgeiefevvyv

    Sequence, based on observed residues (ATOM records): (download) 
    >6xnjA (A:)
gpirkvlllkedheglgisitggkehgvpiliseihpgqpadrcgglhvgdailavngvn
lrdtkhkeavtilsqqrgeiefevvyv

  • Chain 'B':
    No sequence available.