PDB entry 6xne

View 6xne on RCSB PDB site
Description: gcn4-p1 peptide trimer with p-methylphenylalanine residue at position 16 (me-f16)
Deposited on 2020-07-02, released 2021-07-07
The last revision was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GCN4-p1 Peptide with me-F16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Chain 'B':
  Compound: GCN4-p1 Peptide with A16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Chain 'C':
  Compound: GCN4-p1 Peptide with A16
  Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03069 (0-29)
    • engineered mutation (15)
• Heterogens: 4PH, NA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xneA (A:)
  rmkqledkveellskfyhlenevarlkklv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xneB (B:)
  rmkqledkveellskayhlenevarlkklv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6xneC (C:)
  rmkqledkveellskayhlenevarlkklv