PDB entry 6xiy

View 6xiy on RCSB PDB site
Description: Crystal Structure of the Carbohydrate Recognition Domain of the Human Macrophage Galactose C-Type Lectin Bound to methyl 2-(acetylamino)-2-deoxy-1-thio-alpha-D-galactopyranose
Class: signaling protein
Keywords: crd, signaling protein
Deposited on 2020-06-22, released 2021-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 10 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC10A, CLECSF13, CLECSF14, HML
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUN9 (1-128)
      • expression tag (0)
    Domains in SCOPe 2.08: d6xiya1, d6xiya2
  • Heterogens: Q3M, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xiyA (A:)
    scpvnwvehqdscywfshsgmswaeaekycqlknahlvvinsreeqnfvqkylgsaytwm
    glsdpegawkwvdgtdyatgfqnwkpgqpddwqghglgggedcahfhpdgrwnddvcqrp
    yhwvceagl