PDB entry 6xim

View 6xim on RCSB PDB site
Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase(intramolecular oxidoreductse)
Deposited on 1992-04-03, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.151
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xima_
  • Chain 'B':
    Compound: d-xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ximb_
  • Chain 'C':
    Compound: d-xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ximc_
  • Chain 'D':
    Compound: d-xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ximd_
  • Heterogens: XLS, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ximA (A:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ximA (A:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ximB (B:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ximB (B:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ximC (C:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ximC (C:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ximD (D:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ximD (D:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar