PDB entry 6xia

View 6xia on RCSB PDB site
Description: refinement of glucose isomerase from streptomyces albus at 1.65 angstroms with data from an imaging plate
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase(intramolecular oxidoreductse)
Deposited on 1990-09-13, released 1991-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.65 Å
R-factor: 0.141
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-xylose isomerase
    Species: Streptomyces albus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d6xiaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xiaA (A:)
    nyqptpedrftfglwtvgwegrdpfgdatrtaldpvesvrrlaelgahgvtfhdddlipf
    gssdseryehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
    vdaaaargmaferldqlamdhllgarg