PDB entry 6xia

View 6xia on RCSB PDB site
Description: refinement of glucose isomerase from streptomyces albus at 1.65 angstroms with data from an imaging plate
Deposited on 1990-09-13, released 1991-10-15
The last revision prior to the SCOP 1.69 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.65 Å
R-factor: 0.141
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d6xia__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xia_ (-)
    nyqptpedrftfglwtvgwegrdpfgdatrtaldpvesvrrlaelgahgvtfhdddlipf
    gssdseryehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
    vdaaaargmaferldqlamdhllgarg